Domain assignment for gi|417359226|ref|YP_002934579.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
81 204 S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000422 UbiE/COQ5-like 0.016 1vlm A: Alignments

Protein Sequence Details

Sequence length 240
Comment Methyltransferase domain protein [Edwardsiella ictaluri 93-146]
Sequence
MRPALSMRTLNAPFTWRQIPWGLHYRAALELRLTPWWPKLFGYHLLKLGTLSTDLATDRCTISHQVSVAPEGEHLQVIAEPAHLPFAAKSVDACLLAHTLGYSHDPHRVLREVDRVLVDDGWLIISGFSPLSLLGMGKLVPGLRRRLPYSSRMFSMGRLIDWLNLLNYEVLAASRFQVLPWHNPCVSLLSRHFPAMGCLMLIVARKRTVPLTLTPQRVLLAHHSIRRALGSAAKIRRRPV

Download

Sequence (FASTA)