Domain assignment for gi|417359211|ref|YP_002934385.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
27 115 OMPA-like 1.18e-42 Outer membrane enzyme PagP 0.00000489 1mm4 A: Alignments

Protein Sequence Details

Sequence length 116
Comment antimicrobial peptide resistance and lipid A acylation protein PagP [Edwardsiella ictaluri 93-146]
Sequence
MKTYNEIIAALVALPILFAGVASAAEPGVLDTLRNNIVQTWQQPQHYDLYLPAITWHARFAYSREKIDTYNERPWGAGFGQSRWDEKGNWHGLYLMAFKDSFNKWEPIGGYGWEAT

Download

Sequence (FASTA)