Domain assignment for gi|417359192|ref|YP_002934205.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View

Protein Sequence Details

Sequence length 236
Comment outer membrane protein, putative [Edwardsiella ictaluri 93-146]
Sequence
MNKLMYLAALPCLFSASQSWANNYKTSVEYRHEYREGVKKHSDRFKVFLDTGNHIGFEFDARYGNHDDQAYDQMYLNGSELNVFYYTDLNKNTMLLTGNSFDFTSEGLVLIPFVRLNYTFDNGFYINGRYKWKLWDYSMKGIDQQPYHSKIQEFDTFIGYKWGQWNFQYQLDLMREMSANGQPLYNGKKWDYANNFRVVYAIDANWRPFVEIGDIKESRTSDRRQGRYRIGLKYTW

Download

Sequence (FASTA)