Domain assignment for gi|417359174|ref|YP_002934048.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
39 184 OMPA-like 0.000000000141 Outer membrane protein 0.017 1p4t A: Alignments

Protein Sequence Details

Sequence length 184
Comment YfaZ precursor [Edwardsiella ictaluri 93-146]
Sequence
MKKSFYCLVAGSALLLSGAAQAISLNGQAGKDFTNLEVGLGTGSSGLYSTLNWAHSDNDGDIVGLGLGLGVPLGSAIISVGGKAMYLNPKHSGGGSDDYAVAIGGGVNLPLGQSFALYGSAYYAPDSLSSGIKDYTEATGGVRWNVMRPLSVDVGYRYINLAGKNGHRDNAVADGPYVGVGLSF

Download

Sequence (FASTA)