Domain assignment for gi|417359170|ref|YP_002934025.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
105 227 Tetracyclin repressor-like, C-terminal domain 4.14e-29 Tetracyclin repressor-like, C-terminal domain 0.0000259 1t33 A:89-220 Alignments
11 88 Homeodomain-like 7.18e-17 Tetracyclin repressor-like, N-terminal domain 0.00031 1t33 A:1-88 Alignments

Protein Sequence Details

Sequence length 239
Comment transcriptional regulator, TetR family [Edwardsiella ictaluri 93-146]
Sequence
MTTPCINSVMASTTPRGKQARQSLIDAGLTLFAQRGLEGATTRDIALASGQNIAAITYYFHSKQGLYLAVAQWIADTLNASFHPLRTECERFLSRSDATPQAYLALIQRAIAHLCHLMTQPQTLHLSQIISREQMLPSAASPILHDQFISPLHTLMTRLVAGYAGLDATQPAAALHTHALIGQVLAFRMARETILNRTGWPQIGPAQAQAIHEVVQMHTELLMNGLRQRGVVGNVRKPS

Download

Sequence (FASTA)