Domain assignment for gi|417359136|ref|YP_002933644.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
58 322 DNA breaking-rejoining enzymes 5e-46 Lambda integrase-like, catalytic core 0.00000155 1aih A: Alignments

Protein Sequence Details

Sequence length 345
Comment integrase, putative [Edwardsiella ictaluri 93-146]
Sequence
MTIRRLASGKWLCQCFPYGRDGQRIRRQFTTRGEALAFERRMNPRGVSLDMGESATHLSDLILRWYELHGRMLSSGAGRKGKLDAICRRLGDPLAGDFDKGMFARYRERRLNGEWNPKGKKRLQEATVNREQAYLHAVFAELRRLGEWEGGNPLDGIRQFREGDQELAFLYADEITRLLAACDASSKADLGGIVRVCLATGARWSEVQSLRQSQVLPGRLTFTHTKSKKNRTVPISERLQALLPTKQGRLFTPCYEAFKAALARAGLHLPKGQRTHVLRHTFASHFMMQGGNILVLQQILGHSTITMTMRYAHFAPDHLDAALALNPFDNLDTLKKCGGKNGSRI

Download

Sequence (FASTA)