Domain assignment for gi|417359133|ref|YP_002933638.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
99 265 Ribonuclease H-like 4.4e-40 Retroviral integrase, catalytic domain 0.024 1asu A: Alignments

Protein Sequence Details

Sequence length 269
Comment Integrase core domain protein [Edwardsiella ictaluri 93-146]
Sequence
MCRVLRVARSGWYAWRLRRHQITPRQQFRLACDEAVRNAFAEAKQRYGAPRLADELPEYNIKTIAASLRRQGLRAKASRKFSPVSYHEHGLPVSENLLKQDVTACGPNQKWSGDIIYLRTDEGWLYLAVVIDLWSRAVIGWSMSSRMTAQLACDALQMAWWRRKRPGNAIVHTDRGGQYCSADYQTLLKHHNLRGSMSAKGCCYDNACAESFFHTLKVECIHGKHFASREMMRTTVLNYIECDYNRWRRHNACGGLSPEQFEKQNRACT

Download

Sequence (FASTA)