Domain assignment for gi|417359114|ref|YP_002933525.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
8 379 MFS general substrate transporter 1.12e-56 Glycerol-3-phosphate transporter 0.028 1pw4 A: Alignments

Protein Sequence Details

Sequence length 404
Comment drug resistance transporter, Bcr/CflA subfamily [Edwardsiella ictaluri 93-146]
Sequence
MRSKSGFIIYLAGLSMLGYLATDMYLPAFGAMRHDLGASAGAISASLSIFLAGFAFAQLLWGPLSDRIGRKPVLLLGLGMFALACLGMLWVDNTTQLLILRFVQAVGVCSAAVTWQALVIDRYSKGVANRVFATVMPLVALSPALAPLLGAWLLNHFEWQAIFAVLFAITLLLMIPTLRLQEHRAMANRQTPSIGFLRLMRSNIFSGNVLIYAACSAGFFAWLTGSPFILGEMGYSPNDIGLSYVPQTIAFLLGGYGCRALLSRIGGTLLLPWLLVIYSLSMLAMLVMALSYQPGLLALLIPFCVMAMMNGAIYPIVVASALTPFPNNSGKAAALQNTLQLGVCFLASLLVSALIHIPLLATSAIMAGTIPLVMLGYWLKSDSVTTILEKRREQQRGQHALSRR

Download

Sequence (FASTA)