Domain assignment for gi|417359112|ref|YP_002933504.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
9 487 MFS general substrate transporter 2.62e-27 LacY-like proton/sugar symporter 0.025 1pv7 A: Alignments

Protein Sequence Details

Sequence length 490
Comment amino acid/peptide transporter (Peptide:H+ symporter) [Edwardsiella ictaluri 93-146]
Sequence
MSNANNNQAESVSLNAFKQPRAFYLIFSIELWERFGYYGLQGIMAVYLVKMLGMSEADSITLFSSFSALVYGFVAIGGWLGDKVLGAKRVIMLGALVLAIGYAFVAYSGHELSMVYVGMATIAVGNGLFKANPSSLLSTCYEKNDPRLDGAFTMYYMSVNIGSFFSMLATPWLAARFGWSVAFSLSVVGMLITLVNFMMCRRWVKDQGSKPDFAPLQVGKLMMTLVGVVILVAISTWLLHNQTIARWALAIISACIVLIFAKETFALQGGARRKMIVAFLLMLEAVVFFVLYSQMPTSLNFFAIHNVEHSIFGIAFEPEQYQALNPFWIMVASPILAAIYNKMGDRLPMPHKFAIGMVLCSGAFLVLPWGASFANEAGIVSVNWLILSYALQSIGELMISGLGLAMVAQLVPQRLMGFIMGSWFLTTAAAALIAGKVAALTAVPGGEVADPHASLAIYSHVFMQIGIATAVIAVLMLLTAPKLNRMTLGD

Download

Sequence (FASTA)