Domain assignment for gi|417359107|ref|YP_002933466.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 221 Ammonium transporter 1.2e-68 Ammonium transporter 0.00000325 1u7g A: Alignments

Protein Sequence Details

Sequence length 230
Comment ammonium transporter family [Edwardsiella ictaluri 93-146]
Sequence
MLINSGDTAFIILCTAMVCLMTPGLALFYGGLVSERNIISVMLQNFICMGVVAVIWIFGGFSLVFGQDVGGVIGNFFDYFGMLHIGVSVNKAWAPNIPFILFFAYQMMFAIITPALISGAIVGRVKFSAYVKFVFLWVIFVYIPVAHWVWGGGFLEQIGVVDFAGGIVVHVTAGFSALAAALFIGKRVDSVIKSEKPVSLPIVACGAGLLWFGWFGFRAANKTVQQSASR

Download

Sequence (FASTA)