Domain assignment for gi|417359082|ref|YP_002933298.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
90 179 Translation initiation factor IF3, C-terminal domain 1.01e-34 Translation initiation factor IF3, C-terminal domain 0.00000487 2ife A: Alignments
13 86 Translation initiation factor IF3, N-terminal domain 5.36e-29 Translation initiation factor IF3, N-terminal domain 0.00015 1tif A: Alignments

Protein Sequence Details

Sequence length 180
Comment translation initiation factor IF-3, putative [Edwardsiella ictaluri 93-146]
Sequence
MKGGKRVQTARPNRINGEIRAQEVRLTGVDGEQIGIVSLREALEKAEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKASKEQKKKQKVVQVKEIKFRPGTDDGDYQVKLRSLVRFLEDGDKAKITLRFRGREMAHQQIGIEVLNRVKNDLSELAVVESFPSKIEGRQMIMVLAPKKKQ

Download

Sequence (FASTA)