Domain assignment for gi|417359069|ref|YP_002933101.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
23 212 OMPA-like 4.71e-31 Outer membrane protein 0.039 1qj8 A: Alignments

Protein Sequence Details

Sequence length 212
Comment OmpW family protein [Edwardsiella ictaluri 93-146]
Sequence
MKKCSVALCLAAVLAPAAASAHQAGDVIVRAGAATVRPTTSSDNVLGLGGFNVDNNTQLGLTFGYMATDNIGIELLAATPFRHKVSLGGLGNIATVHQLPPTLMAQWYFGRAEDKLRPYLGVGVNYTTFFNNSFDQNATSLGLHDLKATDSWGVAGQAGLDYMVSENWMINASVWYISIDTKVKFRDSSDSQHSINTNINPWVFMFGAGYRF

Download

Sequence (FASTA)