Domain assignment for gi|417359033|ref|YP_002932789.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 124 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.16e-23 Antibiotic resistance proteins 0.029 1lqp A: Alignments

Protein Sequence Details

Sequence length 125
Comment glyoxalase family protein [Edwardsiella ictaluri 93-146]
Sequence
MLITGIDHVVITVQDVEKTLAFYVAGLGMSLDSRNGRLALTFGTQKINIHRQKAEFTPAAQNVTYGSVDICFVAEGDIEQIKAELENRGLEIELGVVPRTGAQGPIDSVYLRDPDGNLVEISVYK

Download

Sequence (FASTA)