Domain assignment for gi|417359029|ref|YP_002932750.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 371 UDP-Glycosyltransferase/glycogen phosphorylase 2.62e-79 UDP-N-acetylglucosamine 2-epimerase 0.017 1v4v A: Alignments

Protein Sequence Details

Sequence length 388
Comment UDP-N-acetylglucosamine 2-epimerase [Edwardsiella ictaluri 93-146]
Sequence
MKHLLCVTGSRAEYGILRRLLMLLSRTEGVKLSIIATGMHCDPKYGSTYKNIVSDGLDLSKVIDINLDSSSNEKIINSMSLCQNAFASIFANHDYDAVMILGDRYEIFSVATVAAMNNIPLIHLHGGEKTLGNYDEFIRHAITKMSSLHLVSTEEYRKRVIQLGEHPSSVINIGALGAENCRSLALPDKQDLESRFGSLVKPYFVVVFHPETLTKVSLTEQTLALITALSVFSEEYDFIFIGSNADTGSEKIINIIKSFCLQSASRYMISVSPEEYLGLVKYSCGLIGNSSSGIIEAPSLNIATINIGDRQKGRVHGDSVIDAACTKAAIIAAIELSQSSCFQQKIAIINNPYYKKNTLENAVGAIVSFLLSDRNVNYKDFYDIDLDV

Download

Sequence (FASTA)