Domain assignment for gi|417359002|ref|YP_002932457.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
10 91 OMPA-like 0.00000000118 Outer membrane protein 0.013 1p4t A: Alignments

Protein Sequence Details

Sequence length 91
Comment hypothetical protein NT01EI_1010 [Edwardsiella ictaluri 93-146]
Sequence
MRKTRDDERTNRLDGYLGYRFNDWRVEYDYTQMYSDALKYNNKKTNYEHNVALSYRINPSFTPYVEVGNVAVNSNSDARQTRYRVGLQYHF

Download

Sequence (FASTA)