Domain assignment for gi|417358995|ref|YP_002932375.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 199 Transmembrane di-heme cytochromes 5.18e-37 Formate dehydrogenase N, cytochrome (gamma) subunit 0.014 1kqf C: Alignments

Protein Sequence Details

Sequence length 199
Comment hypothetical protein NT01EI_0927 [Edwardsiella ictaluri 93-146]
Sequence
MSGAKVVNVHPLWLRLCHWINAIAIFLMILSGWRIYDASPLFDFYFPKQYTLGGWLGGALQWHFAAMWLFALNGVVYLTINVIGGRFRRRFWPISLRQLWQDMADALRGRLAHDDPRHYNAVQKCAYLSAIGAAIVLLLSGLVLWKSVQFPLLRGLLGGYETARYIHFYAMAFVCAFLVVHVVMVALVPKTLLAMLRGR

Download

Sequence (FASTA)