Domain assignment for gi|417358985|ref|YP_002932295.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
208 292 PDZ domain-like 2.37e-16 PDZ domain 0.051 1va8 A:8-107 Alignments
86 188 PDZ domain-like 0.000000000000386 PDZ domain 0.051 1v5l A: Alignments

Protein Sequence Details

Sequence length 451
Comment RIP metalloprotease RseP, putative [Edwardsiella ictaluri 93-146]
Sequence
MGGILWSVLAFLVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRVDRRGTEYVVAAIPLGGYVKMLDERVGSVVPELRHQAFNNKSVLQRAAIVSAGPIANFLFAIIAYWLVFVIGVPSVRPVIANVTPDSIAAAAHITPGMELKSVDGVDTPDWESVRLALVGQIGDGSTTLGVGPFGSQLVSEKTLDLRRWQFDPERQDPVVSLGIIPRGPTIEPVLAEIQKGSAAQKAGLQVGDRIVKVNGIPIRGWRDFALQIHDNPGHALALDIERAGLPVSLALTPESRRAARGLTEGFAGVVPQVIPLPEEYQIIRQYGPFMALYQATDKTWQLMRLTVSMLGKLITGDVKLNNLGGPISIAQGAGASAEYGLVYYLMFLALISVNLGIINLFPLPVLDGGHLLFLALEKLKGGPVSERVQAFGYRIGVILLMLFMGLALFNDFSRL

Download

Sequence (FASTA)