Domain assignment for gi|417358983|ref|YP_002932273.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
93 296 Periplasmic binding protein-like II 1.35e-40 Phosphate binding protein-like 0.013 2esn A:92-303 Alignments
3 87 "Winged helix" DNA-binding domain 1.97e-24 LysR-like transcriptional regulators 0.026 1ixc A:1-89 Alignments

Protein Sequence Details

Sequence length 315
Comment regulator of Gcv operon [Edwardsiella ictaluri 93-146]
Sequence
MSKRLPPLNALRVFDAAARHLSFTKAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSLLLTEEGQSYYLDIKEIFSALNDATRKLQARSAKGALTVSLPPSFAIQWLVPRLSGFNSAYPGIDVRIQAVDREEGKLADDVDVAIFYGRGHWPGLRVERLYAEYLMPVCSPQLLLGEHPLKDPADLAYHTLLHDTSRRDWLAYTRQLGLQHINVQQGPIFSHSAMVVQAAVHGQGIALVNNVMAQTEIEAGRLVCPFNDVLISKNAFYLVCQDAQADLGKISAFRQWILARAAGEQEKFRFRYESDGAGVREEKE

Download

Sequence (FASTA)