Domain assignment for gi|417358959|ref|YP_002931875.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 179 Ribonuclease H-like 2.83e-46 DnaQ-like 3'-5' exonuclease 0.0000000622 1yta A:1-180 Alignments

Protein Sequence Details

Sequence length 181
Comment exonuclease family protein [Edwardsiella ictaluri 93-146]
Sequence
MSASETRLIWIDLEMTGLDPQRDRIIEIATLVTDADLNVLAEGPVIALHQDDAQLALMDEWNVRTHTASGLVARVKASQYDDAAAEQATLDFLRQWVPAGVSPICGNSVGQDRRFLFRYMPELERYFHYRYLDVSTLKELARRWKPEILEGFKKRNTHQALDDIRESVAELTYYRTHFIQP

Download

Sequence (FASTA)