Domain assignment for gi|417358943|ref|YP_002931686.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 291 Carbamate kinase-like 4.45e-75 PyrH-like 0.00000000638 2j0w A:3-294 Alignments
297 393 ACT-like 1.6e-16 Aspartokinase allosteric domain-like 0.00017 2j0w A:295-385 Alignments
377 448 ACT-like 0.0000000000000229 Aspartokinase allosteric domain-like 0.00011 2j0w A:386-449 Alignments

Protein Sequence Details

Sequence length 449
Comment lysine-sensitive aspartokinase 3 [Edwardsiella ictaluri 93-146]
Sequence
MQQTIIAKFGGTSVADADAMLRCADIILSNPAVRVVVLSAAAGVTNHLITLAEGQGAAERLRLIGEVRRIHDAILAALPDGAAIRSEIERMLENIAMLAEAAALATSAALTDELVSHGELMSTLLFSELLRVRGVSVEWFDIRRIMRTDDRFGKAEPDREQLQARAQQSLAPRLAKQLIITQGFIGSESKGRTTTLGRGGSDYTAALLAEALDAARVDIWTDVPGIYTTDPRIVPAARRIDEIAFSEAAEMATFGAKVLHPATLLPAVRCDIPVFVGSSRDPDAGGTLVCNKSAQPPLFRALALRRSQTLLTLHSLNMLHARGFLAEVFGILARHSISVDLITTSEVSIALTLDTTGSCTGGASLLTSALLTELSALCRVEVEEDLALVALIGNQLSSACGVGRRIFGAMEPFNIRMICYGASSHNLCFLVPGNDADAVVRTLHAQLFE

Download

Sequence (FASTA)