Domain assignment for gi|417358942|ref|YP_002931675.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
27 448 Outer membrane efflux proteins (OEP) 4.19e-98 Outer membrane efflux proteins (OEP) 0.0000000000232 1ek9 A: Alignments

Protein Sequence Details

Sequence length 477
Comment type I secretion outer membrane protein, TolC family [Edwardsiella ictaluri 93-146]
Sequence
MQMKKLLPLLIGLSLSGFSALSQAENLMQVYQQAKESNPDLRQAAANRDAAFEKINESRSPLLPQLGLGADYTYTNGFRDSSGLNSNNYGATLALTQTIFDMSKWRQLSLTEKQAGIQDVSYQSSEQTLMLNTATAYFNVLRAIDQLTYTEANKQAIYNQLDQTTQRFKVGLVAITDVQNARAQYDQVLAQEVSARNNLDNSLEALRQITGQYYPQLSALNIDRFSTKRPDDVKALLQEAEKRNLQLLSARLSQDLARQQIKYAETGYMPTLNLTASTGVSNTDYNSLSNAQKETLRGGNGSSYQGQNTVGLSFNLPLYSGGATNSQVKQAQYNFVGASEALDSAHRGVVQNVRSSFNNISAAISSVSAYKQAVVSAQSSLDATQAGYQVGTRTIVDVLNATTALYNAKQNLANARYDYLISQLNIKYALGTLNQNDLLMLNGDLSKTVPTAADSIAPDDAAQAAKANGPIPGGGVR

Download

Sequence (FASTA)