Domain assignment for gi|417358933|ref|YP_002931557.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 360 UDP-Glycosyltransferase/glycogen phosphorylase 1.26e-56 Glycosyl transferases group 1 0.0068 2iw1 A:2-371 Alignments

Protein Sequence Details

Sequence length 364
Comment lipopolysaccharide glycosyltransferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MRILMIIDGLPGGGAEKVVLTLAQYFLAQGDSVSLFSLRDVCHYPLPDGLDYRVIRDTCRAPWRKLSELSRRARQLDETIALAEQKERYDLVLSNLHKTDRIVARSNILRDHNLWFCLHGVFSASYLGHRHGFSRWLKREKIRRIYQGRQIVAVSHAVGEDLCQQFKVTPAQLQAIPNPFDLAAIRRAADAPCPLEGQDYLIHVGRFHPAKRHDRLLEAYAQSGLSAPLVLLGQGSPEQEHMLRALAKTLNVAERVHFAGFQANPYPWIHHARLLVVSSDSEGFGNVLVEALTLGTAVVSTRCPGGPAEIMMGDLARGLCHPDAASLAQALQDIYRNPPAIDDTLLQQYDVAAVCTRYRQLGKT

Download

Sequence (FASTA)