Domain assignment for gi|238921742|ref|YP_002935257.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 287 ATP synthase (F1-ATPase), gamma subunit 1.44e-97 ATP synthase (F1-ATPase), gamma subunit 0.00000000486 1fs0 G: Alignments

Protein Sequence Details

Sequence length 287
Comment ATP synthase F1, gamma subunit, putative [Edwardsiella ictaluri 93-146]
Sequence
MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKTQDRMAASRPYAETMRKVIGHLALGNLEYKHPYLEERDIKRVGYLVVSTDRGLCGGLNINLFKKLLTEMKEWNQKGVDIDLALIGSKAVSFFGSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDRLYVVSNKFINTMSQEPQVIQLLPLPKADDAELKRKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGNLIKELQLVYNKARQASITQELTEIVSGAAAV

Download

Sequence (FASTA)