Domain assignment for gi|238921735|ref|YP_002935250.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 204 S-adenosyl-L-methionine-dependent methyltransferases 1.2e-38 Glucose-inhibited division protein B (GidB) 0.00000011 1jsx A: Alignments

Protein Sequence Details

Sequence length 206
Comment methyltransferase GidB, putative [Edwardsiella ictaluri 93-146]
Sequence
MYKQLDTLLAQAGISLTDQQKQRLLGYVSLLDKWNKAYNLTSVREPRDMLVRHIMDSIVVSPYLQGLRFIDVGTGPGLPGIPLAIVRPDANFTLLDSLGKRVRFLRQVQHELRLDNIEPVQSRVEAFVAEPPFDGVISRAFASLQDMVSWCHHLPAAHHGRFYALKGGVPQDELQSLPAGVSVDQLIRLQVPMLEGERHLVVLKSD

Download

Sequence (FASTA)