Domain assignment for gi|238921718|ref|YP_002935233.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 166 P-loop containing nucleoside triphosphate hydrolases 3.31e-23 Nitrogenase iron protein-like 0.00000928 1np6 A: Alignments

Protein Sequence Details

Sequence length 172
Comment molybdopterin-guanine dinucleotide biosynthesis protein B, putative [Edwardsiella ictaluri 93-146]
Sequence
MTTPPLLGIAAYSGTGKTTLLKQLIPSLKARGIRIALIKHTHHDMDVDTPGKDSYELRKAGADQTLVASDVRWALMSETQERQPLDLRFLASRIDARRCDLILVEGFKHEHIAKIALYRHAVGKPFSGLIDKYVIALASDSRHDCAVPFLDINNPGEIAAFIQRWLKQQAKG

Download

Sequence (FASTA)