Domain assignment for gi|238921703|ref|YP_002935218.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
204 352 ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-35 Histidine kinase 0.000000807 1r62 A: Alignments
132 196 Homodimeric domain of signal transducing histidine kinase 0.000000000000647 Homodimeric domain of signal transducing histidine kinase 0.0026 2c2a A:232-320 Alignments
18 106 PYP-like sensor domain (PAS domain) 0.0000000825 BphP N-terminal domain-like 0.048 2ool A:26-139 Alignments

Protein Sequence Details

Sequence length 355
Comment nitrogen regulation protein NR (II), putative [Edwardsiella ictaluri 93-146]
Sequence
MAEYPTPPHRDLPDAGPLLNALMTCILVLDDDLVIRYANPAAQQLLAQSPRKLFGTPLPDLLSYLSLDISLMRISLRTGQGFTDNEVMLVIDSQPHIMALTAQPLSEGQILLELSPLDSQRRLSQEQLQHSQQVAARDLVRGLAHEIKNPLGGLRGAAQLLARALPDPALTEYTQVIIEQADRLRNLVDRLLGPQRPGQRVTQSIHQVAERVCQLVSLECPGNITLLRDYDPSLPELNHDPEQIEQVLLNITRNALQALGERGGTITLRTRTALQVTLHGERYRLAARIDIEDDGPGVPAQLQDTLFYPMVSGRSGGTGLGLSIARSLIDQHQGKIEFNSWPGHTEFSVYLPIRK

Download

Sequence (FASTA)