Domain assignment for gi|238921691|ref|YP_002935206.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 81 Homeodomain-like 8.72e-16 Tetracyclin repressor-like, N-terminal domain 0.0024 2i10 A:10-78 Alignments
78 186 Tetracyclin repressor-like, C-terminal domain 0.0000000586 Tetracyclin repressor-like, C-terminal domain 0.013 1sgm A:78-188 Alignments

Protein Sequence Details

Sequence length 199
Comment transcriptional regulator, TetR family [Edwardsiella ictaluri 93-146]
Sequence
MARPLQHDRDVALQQAVALFWRRGYFATSMKEIEQALNMRPGSIYAAFGNKAALFSSALTRYTQSQVDAFFALMADYPDPFSGAEAFLRHFGATCSTELPSSVCFLVKSLLELEGRAEDAPLSVVRESLAAMEAAFYRAFREGVSPLVEAEARQMARWLQKEVIGIRIMALQIGNSPALAALVDDSCVTLRRWRASVLS

Download

Sequence (FASTA)