Domain assignment for gi|238921663|ref|YP_002935178.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
79 311 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 4.32e-85 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000271 1eqj A:77-310 Alignments
5 510 Alkaline phosphatase-like 2.75e-73 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000111 1eqj A:3-76,A:311-510 Alignments

Protein Sequence Details

Sequence length 514
Comment 2,3-bisphosphoglycerate-independent phosphoglycerate mutase, putative [Edwardsiella ictaluri 93-146]
Sequence
MSNAKKPMVLVILDGYGYREDQQDNAILNAKRPVMNRLWAEYPHTLISASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEGDFYSNAALTRAVDDAVAAGKAVHIMGLMSPGGVHSHEDHILAMVDLAAQRGAEAIYLHAFLDGRDTPPRSAESTLKRFNDHFTELGKGRIASLIGRYYAMDRDNRWDRVELAYDLLTDAKGEFHADNAIDGLQAAYARGENDEFVKPTVIRTSDQADAAMQDGDALIFMNFRADRARQITRAFVNADFDGFARRKTVRLGSFIMLTEYAADIKTECAYPPASLSNTLGEWLMKHHKTQLRISETEKYAHVTFFYNGGVEDPFNGEDRILINSPKVATYDLQPEMSSAELTEKLVSAISSGKYDTIICNYPNGDMVGHTGVYDAAIKAVEALDICIGQVVDAVQKADGQLLITADHGNAELMRDQESGQPYTAHTNLPVPLIYIGKQASAVEGGKLSDIAPTMLTLMGMEVPQEMTGKPLFIVK

Download

Sequence (FASTA)