Domain assignment for gi|238921653|ref|YP_002935168.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
8 207 Cation efflux protein transmembrane domain-like 7.85e-51 Cation efflux protein transmembrane domain-like 0.0000000301 2qfi A:5-208 Alignments
210 287 Cation efflux protein cytoplasmic domain-like 1.57e-24 Cation efflux protein cytoplasmic domain-like 0.0000572 2qfi A:209-290 Alignments

Protein Sequence Details

Sequence length 300
Comment cation diffusion facilitator family transporter [Edwardsiella ictaluri 93-146]
Sequence
MHQQYARLVKVAALSATVIASILLILKILAWWHTGSVSLLASLVDSLVDIAASLTNLLVIRYALQPADKDHTFGHGKAESLAALAQSMFICGSALFLFLTGFQHLLKPEPMNDPGAGMWVTAFALVCTLALVTFQRWVVRRTQSQAVRADMLHYQSDVLMNGAILISLGLSWYGVARADALFALGIGAYILYSALRMGYDAVQSLLDRALSSEERHQIIRIVREHRGVLGVHDLRTRQSGPTRFIQLHLEMDDTLPLVDAHAIADGVEHDLLQHFPAADVIIHQDPTSVVPAEQKGLWES

Download

Sequence (FASTA)