Domain assignment for gi|238921636|ref|YP_002935151.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 325 Carbohydrate phosphatase 4.03e-109 GlpX-like bacterial fructose-1,6-bisphosphatase 0.000000000116 1ni9 A: Alignments

Protein Sequence Details

Sequence length 336
Comment fructose-1,6-bisphosphatase, class II, putative [Edwardsiella ictaluri 93-146]
Sequence
MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADGAAVNAMRIMLNRVDIDGEIVIGEGEIDEAPMLYIGERVGSGQGDQVDIAVDPIEGTRMTAMGQANALAVMAVGDKGTFLHAPDMYMEKLVVGPQAKGCVDLNLPLEANLCNIAARLGKPLSHLTVITLAKPRHDADIAAMQALGVRVFAIPDGDVAASILTCMPESEVDVMYGIGGAPEGVVSAAVIRALDGDMQGRLLARHQVKGDTPENRRLGEQELQRCEQMGICAGEVLTLGDMARNDNVIFSATGITKGDLLEGIYRKGNVATTETLLIRGKSRTIRRIRSTHYLERKDAQIRDIIL

Download

Sequence (FASTA)