Domain assignment for gi|238921626|ref|YP_002935141.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
12 391 MFS general substrate transporter 4.84e-35 LacY-like proton/sugar symporter 0.059 1pv7 A: Alignments

Protein Sequence Details

Sequence length 400
Comment transporter, major facilitator family [Edwardsiella ictaluri 93-146]
Sequence
MDNPIGIAISQQQQNKNILCLATAQALAGANSVVFYATGAIVGHRLAPYDTLSTLPITLFVTGMAACILPFGYLAKRRGRKAAFMAGTALGMLAGLTAALAVFIAAFELFCLAALMGGAYAAVSLSFRFAAADGVGPERRALALSLVMAGGVAAGVIGPSLIGGSLALWPSYPLVTAFIAQALAAVAAAQVLRRVVIPPVSAQTPSMYRSVRSIARQPGLMRTIFWAAVSYTVMNFLMTAAPLSMHMHGLSLNASTLGIQWHVIAMYAPGFITGRLINRFGAELIGTAGLAITLLAILTGFLGQEVMHYWLLLILLGIGWNLGFTGASANLLNYHRPEERMRVQSLNDFIIFSLMIVGSFLSGVLLNSAGWHAVLLGSLLLVSLALWVMLAGMLHHHRTG

Download

Sequence (FASTA)