Domain assignment for gi|238921621|ref|YP_002935136.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
197 248 Homeodomain-like 0.0000000000806 AraC type transcriptional activator 0.028 1bl0 A:63-124 Alignments

Protein Sequence Details

Sequence length 254
Comment putative transcriptional regulator, AraC family [Edwardsiella ictaluri 93-146]
Sequence
MKLCCDECCAIVLTEKDTDVRFCEGDIVKFTENNLMLVSVENDSIDFSTLDSSLILYVSCDLIKDYLHFLKKDLTHYTPVSRGFPPYMIEPCRTPYVFREAASHSVMRETNEIEFERKRSLTFAALSIFLNNRSFIPFLMRMVRSNISSNVYNMIQNDIHKPWSLTAVASCLCLSPSSLKKKLKNEQTSYSKIVTDCRMRYAVEQLLIFNKNISQVSTLCGYSSTSYFISVFKEYYGVTPLNYVHRYRDGGILP

Download

Sequence (FASTA)