Domain assignment for gi|238921614|ref|YP_002935129.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
17 438 MFS general substrate transporter 1.26e-84 Glycerol-3-phosphate transporter 0.0000000662 1pw4 A: Alignments

Protein Sequence Details

Sequence length 446
Comment phosphoglycerate transporter family protein [Edwardsiella ictaluri 93-146]
Sequence
MWSFLKSRTDAPEIQDSAKVDAAYKYWRIQLMWVMYVGYAAFYFTRKSFNFIMPEMISDLGLSMSDIGIMGTLFYITYGCSKFISGMISDRSNPRYFMGLGLIMTGIINIVFGMSSSLLVLGALWMVNAFFQGWGWPPCSKILTSWYSRAERGSWWAIWNTSHNVGGALIPLLVGFISLHFSWRYGMIIPGIIGIVLGLLMCWRLRDKPVTMGLPSVGKWRNDALELVQESEGKGLSNKEIIKRYVLTNKYIWLLAVSYVLVYIVRTAINDWGNLYLTQTKGYSLMTANSALSLFEVGGFIGSLVAGWGSDRLFRGNRGPMNLIFAIGIFLSVAALWLMPGGSYALQAACFFSIGFFIFGPQMLIGMAAAECSHKDAAGAATGFVGLFAYLGAALSGYPIARVMEVWHWNGFFVVISVAACLSALFLLPFLRAQKDREQNATGGAG

Download

Sequence (FASTA)