Domain assignment for gi|238921604|ref|YP_002935119.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
7 356 Six-hairpin glycosidases 5.65e-92 Cellulases catalytic domain 0.00023 1wzz A:23-341 Alignments

Protein Sequence Details

Sequence length 373
Comment glycosyl hydrolases family 8 protein [Edwardsiella ictaluri 93-146]
Sequence
MKESVYRTLMAAALLCVSVATVGAPCEWHEWEQFRQGYISPDGRVIDPSSPRQVTTSEGQSYALFFALVNNDRALFGKLLAWTQNNLSQGSLSQRLPAWKWGRHDDGRWRILDDNSASDADLWIAYTLLEAGRLWQDSDYQHLSIQLLARIAREEVVSLPGFGMMLLPGRQGFRSGALWTINPSYLPPQILARIAPLHGPWNRLQYSALRMLEASSPHGIVPDWTNWQRNKGWLPTPGRAYISGYDAIRAYLWAGMLADGAPAKSALVKHWQPMVALSERLGYIPEKVGVLGVEPQGEGNVGFSAAMLPFLDASNSPLLAAQRQRVKDNLPGNNNYYSSVLTLFGLGWDQRRYRFNLQGELVPNWGSVCDVSD

Download

Sequence (FASTA)