Domain assignment for gi|238921594|ref|YP_002935109.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
31 251 EAL domain-like 5.89e-32 EAL domain 0.0092 2bas A:2-262 Alignments

Protein Sequence Details

Sequence length 257
Comment hypothetical protein NT01EI_3746 [Edwardsiella ictaluri 93-146]
Sequence
MNIGNIVSGGPGAVSLLHHDTLGSADWQSCGREYTFQPIYSTCGRLLAIELLTQVAHPDQPTQRLSPELYFANIPLSLRLQVLLEQLRLVHHWRAFFGQYGLFVSINVDGQVLHALQKKAEAVTLIGELPFLRFEILEHVHGSAPIHGLPDLHRLWLDDFGSGLANFSSLIDVRYEFVKLDRAVFALLCQTQQGTDLFMALVAMMRQYSRGVIVEGVETAQAWQLVQRSDACAAQGYYLSRPLQFERLPLLPQRFAG

Download

Sequence (FASTA)