Domain assignment for gi|238921587|ref|YP_002935102.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
9 279 S-adenosyl-L-methionine-dependent methyltransferases 1.57e-101 LPG1296-like 0.00000404 2oo3 A:9-279 Alignments

Protein Sequence Details

Sequence length 280
Comment hypothetical protein NT01EI_3740 [Edwardsiella ictaluri 93-146]
Sequence
MLSYRHSFHAGNHADVLKHTVQSLIIAALKEKDKPFLYLDTHAGAGRYLLSGEHAEKTGEYLEGIARLWQRDDLPEALTPYMDAVRHFNRSGQLRYYPGSPLLARQLLREQDRLHLSELHPSDFPLLRAEFQKDGRARVVRENGYQQLKSQLPPATRRGLILIDPPYELKSDYQDVVKGIQEGHKRFATGTYALWYPVVLRQNIKRMVHTLEETGIRRILQIELAVRPDSDQRGMTASGMIVINPPWKLEEQMRSLLPWLHQALVPQETGHASVNWIVPE

Download

Sequence (FASTA)