Domain assignment for gi|238921584|ref|YP_002935099.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
7 247 S-adenosyl-L-methionine-dependent methyltransferases 3.4e-74 YhiQ-like 0.0000000112 2oyr A:1-250 Alignments

Protein Sequence Details

Sequence length 250
Comment Protein of unknown function (DUF548) [Edwardsiella ictaluri 93-146]
Sequence
MAAVQLLAEEGADAAALSALAQRWGLCHDADAVLALVLTPQRLELRKLDEPKLGAIFVDFVGGTLAHRRRFGGGRGEAVAKAVGIKGGYLPDVVDATAGLGRDAFVLASLGCRVRMLERHPAVAALLDDGLQRGYADAEIGPWLRERLTLLHASSIEALATLTPRPEVVYLDPMFPHRQKSALVKKDMRVFQALVGADDDADALLAPARRLATKRVVVKRPDYAPPLAGVATPNATLTKSHRFDIYAPLA

Download

Sequence (FASTA)