Domain assignment for gi|238921564|ref|YP_002935079.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 210 Transmembrane di-heme cytochromes 2.04e-53 Formate dehydrogenase N, cytochrome (gamma) subunit 0.0000000246 1kqf C: Alignments

Protein Sequence Details

Sequence length 216
Comment formate dehydrogenase, gamma subunit, putative [Edwardsiella ictaluri 93-146]
Sequence
MSKNNLILRTRFIDRACHWTVVICFFLVALSGIALFFPTLQWLTETFGTPQMGRILHPFFGVLIFVTLLVMFFRFVRHNLFERQDIPWFKGIIEVLKGNEHLVARVGKYNPGQKAMFWSIMSLILVLLITGIIIWRPYFADRFPIPLVRYSLLLHAVAAIVLIHAILIHIYMAFWVKGSIKGMVEGKVSRRWARKHHPRWLEGVEEKEAQSGKKPG

Download

Sequence (FASTA)