Domain assignment for gi|238921542|ref|YP_002935057.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 211 Periplasmic binding protein-like II 9.81e-46 Phosphate binding protein-like 0.0015 1wdn A: Alignments

Protein Sequence Details

Sequence length 212
Comment bacterial extracellular solute-binding protein, family 3 [Edwardsiella ictaluri 93-146]
Sequence
MLSKSPSGKIEGVEMDIFNAFCKKNDCTLRVKEYTFEGMLGALASGQADVAFSAISITPKREAVMDFSKPYYENSWNLVSMTSRNIKITDLSQLKKYKIGYPRGMAYSGLIKSKLQPKGYYQLSDVRLYPSYSETMQDLKNGNIDLAFVEDPVLIFYKNKKNYPIINSYSFKRMDSLGFAFKKNSPLRNQFNQFLDEEGQEKINVIVDKWMK

Download

Sequence (FASTA)