Domain assignment for gi|238921540|ref|YP_002935055.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 227 P-loop containing nucleoside triphosphate hydrolases 2.03e-67 ABC transporter ATPase domain-like 0.0000194 1b0u A: Alignments

Protein Sequence Details

Sequence length 242
Comment ABC transporter, ATP-binding protein, putative [Edwardsiella ictaluri 93-146]
Sequence
MSLISIRNLVKKYEENYVLAGIDLDIESGEVKVIMGPSGCGKTTLIMCLNRLVEPDSGDIYIHGENIMAPGVDIQQLRKKFGFVFQSFALYRHLTVRENITLGLRKLCGMSRQQASERAMHELARFEMAVHAEKLPKQLSGGQKQRVALARALSMDPEILIFDEPTSALDPIMTREVASLINRLHGGVTLVCVTHDVLLAEQISDKVTFLDKGMVRAQGSIQALKQQQQESIRDFFGRYGNV

Download

Sequence (FASTA)