Domain assignment for gi|238921524|ref|YP_002935039.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
20 378 Nucleotide-diphospho-sugar transferases 1.04e-77 glucose-1-phosphate thymidylyltransferase 0.00000919 1yp2 A:10-316 Alignments
313 412 Trimeric LpxA-like enzymes 9.9e-20 GlmU C-terminal domain-like 0.021 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 426
Comment glucose-1-phosphate adenylyltransferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MVKSDNQNKLMLARQLPQQSVALILAGGRGSRLKDLTKTRAKPAVHFGGKFRIIDFALSNCINSGIRRIGVITQYHSHTLVQHIQRGWSILNESMNEFVDLLPAQQRDASETWYRGTADAVYQNLDIIRRYQADYVVILAGDHIYKMDYSRMLLDHVENGAGCTVACIPVPRAEANAFGVMEVSDDHRILNFLEKPAQPPGMPGDPEMSLASMGIYVFNANYLFQLLEEDIHTPGSCHDFGQDLIPKATAQGRAWAHPFTLSCVTSGNADTPPYWRDVGTLDAYWRANLDLASVTPELDMYDNHWPIRTHMESLPPAKFVQDRSGSHGMTMNSLVSGGCIISGSVVVHSVLFPRVRINSFCTIDSSVLLPDVYIGRSCRLRRCIVDRACHLPEGMVIGENAEEDSRRFYRSESGIVLVTREMLARL

Download

Sequence (FASTA)