Domain assignment for gi|238921502|ref|YP_002935017.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
95 184 Fe-S cluster assembly (FSCA) domain-like 1e-24 NifU C-terminal domain-like 0.0019 1veh A: Alignments
1 97 HesB-like domain 1.94e-21 HesB-like domain 0.0013 1nwb A: Alignments

Protein Sequence Details

Sequence length 191
Comment IscR-regulated protein YhgI [Edwardsiella ictaluri 93-146]
Sequence
MIRITEAAQEHFAKLLANQEPGTQIRVFVINPGTPNAECGVSYCPPDAVEANDRKLDFEQLSAYVDEISAPFLDDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLIERVEYILQSQINPQLAGHGGRVSLMEITDEGYAILQFGGGCNGCSMVDYTLKEGIEKELLQRFPELKGVRDLTEHQRGDHSYY

Download

Sequence (FASTA)