Domain assignment for gi|238921469|ref|YP_002934984.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 268 S-adenosyl-L-methionine-dependent methyltransferases 1.87e-73 N6 adenine-specific DNA methylase, DAM 0.0000214 2dpm A: Alignments

Protein Sequence Details

Sequence length 272
Comment DNA adenine methylase family protein [Edwardsiella ictaluri 93-146]
Sequence
MKKKRAFLKWAGGKYPLIEEIRRHLPAGERLIEPFVGAGSVFLNTDYDEYLLADINADLVGLYNIVKDETDRFISDARQMFCPELNVSEEYYRIREAFNLCDDRYQRALYFLYLNRHCYNGLCRYNAKGEFNVPFGRYKKPYFPQEELEFFARKAERAVFVCEHYQQTMLRAQPGAVVYCDPPYAPLSATANFTAYHVNGFGFAEQMRLAELAGELAQRQVPVLISNHETPLTREWYAQADALHVVKVRRTISRKTDGRSKVNELLALYGKR

Download

Sequence (FASTA)