Domain assignment for gi|238921466|ref|YP_002934981.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 330 Nucleotidylyl transferase 1.26e-97 Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000154 1d2r A: Alignments

Protein Sequence Details

Sequence length 334
Comment tryptophanyl-tRNA synthetase, putative [Edwardsiella ictaluri 93-146]
Sequence
MSKPIVFSGAQPSGELTIGNYMGALRQWVQMQDEYDCIYCIVDQHAITVRQDAEKLRSATLDTLALYLACGIDPQKSTIFVQSHVPEHAQLGWVLNCYTYFGELSRMTQFKDKSARYAENINAGLFDYPVLMAADILLYQTHQVPVGEDQKQHLELSRDVAARFNALYGDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDENRNNVIGLLEDPKAVTKKIKRAVTDSDEPPVVRYDVVNKAGVSNLLDILSGVTGKRIGDLEAEFAGKMYGHLKGAVADAVSGMLSELQERYHRFRNDEAYLQEVMRDGAAKARARAAQTLDKVYDAIGFVARP

Download

Sequence (FASTA)