Domain assignment for gi|238921462|ref|YP_002934977.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 387 MFS general substrate transporter 2.35e-36 Glycerol-3-phosphate transporter 0.038 1pw4 A: Alignments

Protein Sequence Details

Sequence length 394
Comment transporter, major facilitator family [Edwardsiella ictaluri 93-146]
Sequence
MTDSNRIRLTWISFFSYALTGALVIVTGMVMGNIAEYFNLPISSMSNTFTFLNTGILVSIFLNAWLMEIIPLKRQLVFGFILMILAIAGLMVGHNLAIFSACMFVLGVVSGITMSIGTFLITHIYTGRQRGSRLLFTDSFFSMAGMVFPIIAATLLAQHVAWYWVYACIGVLYLAIFILTLCSDFPQLGKQAVGDSQPVRKEKWGIGVLFLSIAALCYILGQLGFIQWVPEYAAKRFGMSIEESGGLVSNFWTAYMVGMWFFSVALRFFDLQRIVTVLAALSTFMMYMFVSSQQSAMLSMYILGLGFVSSAIYTTLITLGSQQTKVSSPKLVNFILTCGTIGTMLTFVVTGPIVAHSGAHAALATANGLYLVVFVMCVLLGFVTKHRLHGHAAK

Download

Sequence (FASTA)