Domain assignment for gi|238921440|ref|YP_002934955.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 92 Ribosomal proteins S24e, L23 and L15e 1.8e-30 L23p 0.00000922 2qam T:1-93 Alignments

Protein Sequence Details

Sequence length 100
Comment ribosomal protein L23 [Edwardsiella ictaluri 93-146]
Sequence
MIREERLLKVLRAPHVSEKASMAMEKNNTIVLKVATDATKAEIKAAVKKLFEVEVDTVRTLVVKGKVKRHGQRIGRRSDWKKAYVTLKEGQNLDFIGGAE

Download

Sequence (FASTA)