Domain assignment for gi|238921435|ref|YP_002934950.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 133 Ribosomal protein L16p/L10e 1.7e-54 Ribosomal protein L16p 0.000000421 2gya K:3-133 Alignments

Protein Sequence Details

Sequence length 136
Comment 50S ribosomal protein L16, putative [Edwardsiella ictaluri 93-146]
Sequence
MLQPKRTKFRKVHKGRNRGLAQGTDVSFGTFGLKAVGRGRLTARQIEAARRAMTRAVKRQGKIWIRVFPDKPITEKPLAVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFKLAAAKLPIKTTFVTKTVM

Download

Sequence (FASTA)