Domain assignment for gi|238921415|ref|YP_002934930.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 65 Gated mechanosensitive channel 0.0000000000262 Gated mechanosensitive channel 0.008 2oar A:10-118 Alignments

Protein Sequence Details

Sequence length 77
Comment Large-conductance mechanosensitive channel, MscL [Edwardsiella ictaluri 93-146]
Sequence
MRKAIGSTPALVANYGQFIQAIFDFIIVTFAIFMAIKPINKLRRQKTAETPPAPSAEAVLLTEIRELLKAQLKDKYT

Download

Sequence (FASTA)