Domain assignment for gi|238921414|ref|YP_002934929.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
13 56 Gated mechanosensitive channel 0.0000000000183 Gated mechanosensitive channel 0.0064 2oar A:10-118 Alignments

Protein Sequence Details

Sequence length 58
Comment hypothetical protein NT01EI_3565 [Edwardsiella ictaluri 93-146]
Sequence
MRLLKEFREFAMCGKVVDMAFGVIIAAVFGKIVSPRSGDVIMPLLRLLIGGTGFKQFH

Download

Sequence (FASTA)