Domain assignment for gi|238921397|ref|YP_002934912.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 266 NAD(P)-linked oxidoreductase 5.5e-83 Aldo-keto reductases (NADP) 0.0000000212 1mzr A: Alignments

Protein Sequence Details

Sequence length 276
Comment oxidoreductase, aldo/keto reductase family [Edwardsiella ictaluri 93-146]
Sequence
MSIPPFITLNDGNRIPQLGLGVWQVSDTLARNVVGEALRIGYRAIDTAAIYGNESGVGQALQQSGLTRNSLFITTKLWNADHMAVDKAFHDSLHKLHLEYVDLYLIHWPMALQDTFVHAWRRLIDLRRQGLVKSIGVCNFNIVHLQRLLDETGVVPSINQIELHPLMQQRELQSWNSHNGIATEAWSPLAQGGKGVFDAELIHRLAAKYNKTPAQIVIRWHLDSGRIVIPKTVSAMRLRENIAVFDFTLETSERAQIARLECGKRLGSDPATYMRL

Download

Sequence (FASTA)